{"product_id":"proteintech-21984-1-ap","title":"Proteintech, 21984-1-AP, ROM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ROM1 (21984-1-AP) by Proteintech is a Polyclonal antibody targeting ROM1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21984-1-AP targets ROM1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, HeLa cells,  rat eye tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nROM1 (also known as TSPAN23) is a transmembrane protein present in photoreceptor outer segment disc membranes. ROM1 belongs to the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. ROM1 is required for rod photoreceptor viability and the regulation of disk morphogenesis (PMID: 10802659). It may function as an adhesion molecule involved in stabilization and compaction of outer segment disks.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17049 Product name: Recombinant human ROM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-270 aa of BC008100 Sequence: LALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGS Predict reactive species\nFull Name: retinal outer segment membrane protein 1\nCalculated Molecular Weight: 351 aa, 37 kDa\nObserved Molecular Weight: 37-45 kDa\nGenBank Accession Number: BC008100\nGene Symbol: ROM1\nGene ID (NCBI): 6094\nRRID: AB_2878961\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03395\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868929839273,"sku":"21984-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21984-1-ap","provider":"Iright","version":"1.0","type":"link"}