{"product_id":"proteintech-22026-1-ap","title":"Proteintech, 22026-1-AP, NPHP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPHP3 (22026-1-AP) by Proteintech is a Polyclonal antibody targeting NPHP3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, canine samples\n22026-1-AP targets NPHP3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HepG2 cells,  HEK-293 cells,  mouse liver tissue,  human testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells, MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16888 Product name: Recombinant human NPHP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC068082 Sequence: MGTASSLVSPAGGEVIEDTYGAGGGEACEIPVEVKPKARLLRNSFRRGAGAAAGAGPGSLPRGVGAGGLLGASFKSTGSSVPELEYAAAEYERLRKEYEIFRVSKNQELLSMGRREAKLDTENKRLRAELQ Predict reactive species\nFull Name: nephronophthisis 3 (adolescent)\nCalculated Molecular Weight: 1330 aa, 151 kDa\nObserved Molecular Weight: 145-151 kDa\nGenBank Accession Number: BC068082\nGene Symbol: NPHP3\nGene ID (NCBI): 27031\nRRID: AB_2878975\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z494\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868958511273,"sku":"22026-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22026-1-ap","provider":"Iright","version":"1.0","type":"link"}