{"product_id":"proteintech-22042-1-ap","title":"Proteintech, 22042-1-AP, CALHM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CALHM1 (22042-1-AP) by Proteintech is a Polyclonal antibody targeting CALHM1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22042-1-AP targets CALHM1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalcium homeostasis modulator 1 (CALHM1) is a membrane protein with four transmembrane helices that form an octameric ion channel with voltage-dependent activation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14938 Product name: Recombinant human CALHM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-346 aa of BC036193 Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTNGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV Predict reactive species\nFull Name: calcium homeostasis modulator 1\nCalculated Molecular Weight: 346 aa, 38 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC036193\nGene Symbol: CALHM1\nGene ID (NCBI): 255022\nRRID: AB_11182709\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IU99\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869448622249,"sku":"22042-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22042-1-ap","provider":"Iright","version":"1.0","type":"link"}