{"product_id":"proteintech-22060-1-ap","title":"Proteintech, 22060-1-AP, CDK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK2 (22060-1-AP) by Proteintech is a Polyclonal antibody targeting CDK2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n22060-1-AP targets CDK2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  K-562 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily. It is dispensable for myelination but is important for adult oligodendrocyte progenitor cell renewal, and could be one of the underlying mechanisms that drive adult progenitors to differentiate and thus regenerate myelin(PMID:21502361). G2 phase CCNA1\/CDK2 controls the timing of entry into mitosis by controlling the subsequent activation of CCNB\/CDK1, but also has an unexpected role in coordinating the activation of CCNB\/CDK1 at the centrosome and in the nucleus(PMID:18372919). It has 2 isoforms produced by alternative splicing with the molecular weight of 34 kDa and 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species\nFull Name: cyclin-dependent kinase 2\nCalculated Molecular Weight: 298 aa, 34 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC003065\nGene Symbol: CDK2\nGene ID (NCBI): 1017\nRRID: AB_2878982\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24941\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978106537,"sku":"22060-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22060-1-ap","provider":"Iright","version":"1.0","type":"link"}