{"product_id":"proteintech-22069-1-ap","title":"Proteintech, 22069-1-AP, OXGR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OXGR1 (22069-1-AP) by Proteintech is a Polyclonal antibody targeting OXGR1 in WB, ELISA applications with reactivity to human, mouse samples\n22069-1-AP targets OXGR1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  HeLa cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\n2-oxoglutarate receptor 1(OXGR1) also known as GPR99, belongs to the G-protein coupled receptor family. OXGR1is expressed in renal cortical connecting tubule and collecting duct type B intercalated cells. When stimulated by its ligand, OXGR1 mediates cellular calcium uptake, which acts as a signal to promote the chloride-bicarbonate exchanger SLC26A4. Dominant loss-of-function OXGR1 variants are associated with recurrent calcium oxalate NL\/NC disease(PMID: 36571463).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17186 Product name: Recombinant human OXGR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 255-337 aa of BC103881 Sequence: LPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP Predict reactive species\nFull Name: oxoglutarate (alpha-ketoglutarate) receptor 1\nCalculated Molecular Weight: 337 aa, 38 kDa\nObserved Molecular Weight: 38-42 kDa\nGenBank Accession Number: BC103881\nGene Symbol: OXGR1\nGene ID (NCBI): 27199\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96P68\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887748239529,"sku":"22069-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22069-1-ap","provider":"Iright","version":"1.0","type":"link"}