{"product_id":"proteintech-22092-1-ap","title":"Proteintech, 22092-1-AP, IMPDH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IMPDH1 (22092-1-AP) by Proteintech is a Polyclonal antibody targeting IMPDH1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22092-1-AP targets IMPDH1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse spleen tissue,  A431 cells,  K-562 cells,  Raji cells,  rat spleen tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human tonsillitis tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIMPDH1(Inosine-5'-monophosphate dehydrogenase 1) is also named as IMPD1, IMP dehydrogenase 1 and belongs to the IMPDH\/GMPR family. It catalyzes the rate limiting step of de novo guanine synthesis and an important target for the development of drugs with both chemotherapeutic and immunosuppressive activity. It may also have a role in the development of malignancy and the growth progression of some tumors. This protein has some isoforms produced by alternative splicing with the molecular mass of 53-65 kDa. This antibody may has cross reaction with IMPDH2 due to their high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17297 Product name: Recombinant human IMPDH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-235 aa of BC033622 Sequence: LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV Predict reactive species\nFull Name: IMP (inosine monophosphate) dehydrogenase 1\nCalculated Molecular Weight: 563 aa, 60 kDa\nObserved Molecular Weight: 53-60 kDa\nGenBank Accession Number: BC033622\nGene Symbol: IMPDH1\nGene ID (NCBI): 3614\nRRID: AB_2878992\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20839\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868882129065,"sku":"22092-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22092-1-ap","provider":"Iright","version":"1.0","type":"link"}