{"product_id":"proteintech-22093-1-ap","title":"Proteintech, 22093-1-AP, TLE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLE1 (22093-1-AP) by Proteintech is a Polyclonal antibody targeting TLE1 in WB, ELISA applications with reactivity to human samples\n22093-1-AP targets TLE1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17299 Product name: Recombinant human TLE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-377 aa of BC010100 Sequence: KDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPH Predict reactive species\nFull Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)\nCalculated Molecular Weight: 770 aa, 83 kDa\nObserved Molecular Weight: 85-95 kDa\nGenBank Accession Number: BC010100\nGene Symbol: TLE1\nGene ID (NCBI): 7088\nRRID: AB_3669386\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q04724\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887828750505,"sku":"22093-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22093-1-ap","provider":"Iright","version":"1.0","type":"link"}