{"product_id":"proteintech-22104-1-ap","title":"Proteintech, 22104-1-AP, GSK3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSK3B (22104-1-AP) by Proteintech is a Polyclonal antibody targeting GSK3B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22104-1-AP targets GSK3B in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  PC-3 cells,  mouse thymus tissue,  rat thymus tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human lung cancer tissue, human prostate hyperplasia tissue,  human testis tissue,  rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase.GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to INS regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution. This antibody recognize the C-terminal of GSK3B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, chicken, zebrafish, bovine, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species\nFull Name: glycogen synthase kinase 3 beta\nCalculated Molecular Weight: 433 aa, 48 kDa\nObserved Molecular Weight: 46-48 kDa\nGenBank Accession Number: BC000251\nGene Symbol: GSK3B\nGene ID (NCBI): 2932\nRRID: AB_2878997\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49841\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887956316329,"sku":"22104-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22104-1-ap","provider":"Iright","version":"1.0","type":"link"}