{"product_id":"proteintech-22170-1-ap","title":"Proteintech, 22170-1-AP, CPT1B-specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPT1B-specific (22170-1-AP) by Proteintech is a Polyclonal antibody targeting CPT1B-specific in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n22170-1-AP targets CPT1B-specific in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, mouse heart tissue,  rat heart tissue,  rat skeletal muscle tissue\nPositive IP detected in: mouse heart tissue, mouse skeletal muscle tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarnitine palmitoyltransferases (CPTs) mediate the transport of long chain fatty acyl groups into the mitochondrial matrix to undergo b-oxidation. Type I CPT resides in the outer mitochondrial membrane. Mammalian tissues express three isoforms: CPT1A (liver), CPT1B (muscle and heart), and CPT1C (brain). Several isoforms of CPT1B exist due to the alternative splicing, with predicted MW of 88\/84\/79\/66 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, zebrafish, sheep, ewes\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17840 Product name: Recombinant human CPT1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-250 aa of BC131570 Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF Predict reactive species\nFull Name: carnitine palmitoyltransferase 1B (muscle)\nCalculated Molecular Weight: 567 aa, 64 kDa\nObserved Molecular Weight: 75-85 kDa\nGenBank Accession Number: BC131570\nGene Symbol: CPT1B\nGene ID (NCBI): 1375\nRRID: AB_2713959\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92523\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868831371433,"sku":"22170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22170-1-ap","provider":"Iright","version":"1.0","type":"link"}