{"product_id":"proteintech-22201-1-ap","title":"Proteintech, 22201-1-AP, CNGA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNGA4 (22201-1-AP) by Proteintech is a Polyclonal antibody targeting CNGA4 in WB, ELISA applications with reactivity to mouse, rat samples\n22201-1-AP targets CNGA4 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCNGA4 (cyclic nucleotide gated channel subunit alpha 4), also known as CNG4. It is expected to be located in cell membrane. Cyclic nucleotide-gated (CNG) channels are crucial for visual and olfactory transductions (PMID: 12432397). Native CNG channels are heterotetramers composed of homologous A and B subunits. Olfactory CNG channels are composed of three types of subunits, CNGA2, CNGA4, and CNGB1b (PMID: 15134638). CNGA4 is a modulatory subunit which contributes to the high cAMP sensitivity of the native olfactory channel. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation of native olfactory neurons to odorants (PMID: 11739959; 11739960). The molecular weight of CNGA4 is 65 kDa, and it can recognize the 48 kDa isoform.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17481 Product name: Recombinant human CNGA4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-394 aa of BC106936 Sequence: TIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLA Predict reactive species\nFull Name: cyclic nucleotide gated channel alpha 4\nCalculated Molecular Weight: 575 aa, 66 kDa\nObserved Molecular Weight: 47-50 kDa, 65-70 kDa\nGenBank Accession Number: BC106936\nGene Symbol: CNGA4\nGene ID (NCBI): 1262\nRRID: AB_3669391\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IV77\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886675284137,"sku":"22201-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22201-1-ap","provider":"Iright","version":"1.0","type":"link"}