{"product_id":"proteintech-22208-1-ap","title":"Proteintech, 22208-1-AP, Cytokeratin 7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 7 (22208-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 7 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n22208-1-AP targets Cytokeratin 7 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human lung cancer tissue, human bowen disease,  human breast cancer tissue,  human kidney tissue,  human ovary cancer tissue,  human ovary tumor tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\nPositive IF\/ICC detected in: A549 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17528 Product name: Recombinant human KRT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ Predict reactive species\nFull Name: keratin 7\nCalculated Molecular Weight: 469 aa, 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC002700\nGene Symbol: Cytokeratin 7\nGene ID (NCBI): 3855\nRRID: AB_2879030\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08729\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869529362601,"sku":"22208-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22208-1-ap","provider":"Iright","version":"1.0","type":"link"}