{"product_id":"proteintech-22226-1-ap","title":"Proteintech, 22226-1-AP, iNOS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe iNOS (22226-1-AP) by Proteintech is a Polyclonal antibody targeting iNOS in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n22226-1-AP targets iNOS in WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, RAW 264.7 cells\nPositive FC (Intra) detected in: LPS treated RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOS2, also named as iNOS and NOS2A, produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission, antimicrobial and antitumoral activities. NOS2 is a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. iNOS has a very short half-life due to rapid degradation by calpain. iNOS monomer is a direct substrate of calpain I and can be cleaved by calpain I at the canonical CaM-binding site(503-532aa) of iNOS, and then a ~70kD band can be detected by western (PMID:11786228).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17567 Product name: Recombinant human NOS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC130283 Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAT Predict reactive species\nFull Name: nitric oxide synthase 2, inducible\nCalculated Molecular Weight: 1153 aa, 131 kDa\nObserved Molecular Weight: 110-130 kDa, 65-70 kDa\nGenBank Accession Number: BC130283\nGene Symbol: iNOS\nGene ID (NCBI): 4843\nRRID: AB_2879038\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35228\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822655145,"sku":"22226-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22226-1-ap","provider":"Iright","version":"1.0","type":"link"}