{"product_id":"proteintech-22233-1-ap","title":"Proteintech, 22233-1-AP, C4 Alpha Chain\/C4b\/C4d Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C4 Alpha Chain\/C4b\/C4d (22233-1-AP) by Proteintech is a Polyclonal antibody targeting C4 Alpha Chain\/C4b\/C4d in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n22233-1-AP targets C4 Alpha Chain\/C4b\/C4d in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, human blood,  mouse liver tissue\nPositive IP detected in: L02 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:4000-1:40000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular wights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1017-1336aa of human C4-A protein can recognize C4 precursor, C4 alpha chain, C4b, and C4d.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17583 Product name: Recombinant human C4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1017-1336 aa of BC063289 Sequence: YLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEIASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTQAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR Predict reactive species\nFull Name: complement component 4A (Rodgers blood group)\nCalculated Molecular Weight: 1744 aa, 193 kDa\nObserved Molecular Weight: 80-95 kDa, 200 kDa\nGenBank Accession Number: BC063289\nGene Symbol: C4 Gamma Chain\nGene ID (NCBI): 720\nRRID: AB_2879042\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0C0L4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868923220137,"sku":"22233-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22233-1-ap","provider":"Iright","version":"1.0","type":"link"}