{"product_id":"proteintech-22238-1-ap","title":"Proteintech, 22238-1-AP, CEACAM1\/CD66a Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEACAM1\/CD66a (22238-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM1\/CD66a in IHC, ELISA applications with reactivity to human samples\n22238-1-AP targets CEACAM1\/CD66a in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCEACAM1, also known as CD66a or BGP (biliary glycoprotein), is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in the control of cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). CEACAM1 is a transmembrane glycoprotein that is expressed on epithelial, endothelial, and immune cells (PMID: 30314283). CEACAM1 has been demonstrated to play a role in morphogenesis, apoptosis, angiogenesis, cell proliferation, cell motility, fibrosis, and immunity (PMID: 31604530).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17651 Product name: Recombinant human CEACAM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 317-459 aa of BC014473 Sequence: IVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGR Predict reactive species\nFull Name: carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)\nCalculated Molecular Weight: 526 aa, 58 kDa\nGenBank Accession Number: BC014473\nGene Symbol: CEACAM1\nGene ID (NCBI): 634\nRRID: AB_3669392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13688\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886435782825,"sku":"22238-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22238-1-ap","provider":"Iright","version":"1.0","type":"link"}