{"product_id":"proteintech-22251-1-ap","title":"Proteintech, 22251-1-AP, FAM98B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM98B (22251-1-AP) by Proteintech is a Polyclonal antibody targeting FAM98B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22251-1-AP targets FAM98B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Caco-2 cells,  Raji cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM98B (Family with Sequence Similarity 98 Member B) is a protein-coding gene that has been identified as a component of the human tRNA ligase complex (tRNA-LC), which plays a crucial role in tRNA splicing, RNA repair, and other cellular processes. FAM98B contains a glycine-rich intrinsically disordered region (IDR) that can aggregate, leading to the formation of pathological aggregates associated with neurodegenerative diseases. In a study, FAM98B was found to be depleted in patient tissues with abnormal tRNA splicing intermediates, indicating its role in these diseases. (PMID: 34854379, PMID: 40674500)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17747 Product name: Recombinant human FAM98B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-186 aa of BC093898 Sequence: LEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQ Predict reactive species\nFull Name: family with sequence similarity 98, member B\nCalculated Molecular Weight: 330 aa, 37 kDa\nObserved Molecular Weight: 45-48 kDa\nGenBank Accession Number: BC093898\nGene Symbol: FAM98B\nGene ID (NCBI): 283742\nRRID: AB_2879049\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q52LJ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869540405417,"sku":"22251-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22251-1-ap","provider":"Iright","version":"1.0","type":"link"}