{"product_id":"proteintech-22339-1-ap","title":"Proteintech, 22339-1-AP, BTG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BTG2 (22339-1-AP) by Proteintech is a Polyclonal antibody targeting BTG2 in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n22339-1-AP targets BTG2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse small intestine tissue, human kidney tissue,  mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Neuro-2a cells\nPositive FC (Intra) detected in: SH-SY5Y cells, Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein BTG2, the anti-proliferative human homolog of murine Pc3\/Tis21, belongs to the BTG\/Tob family. This family has structurally related proteins that appear to have anti-proliferative properties. It has been demonstrated that BTG2 is p53-inducible and is involved in cell cycle control and cellular response to DNA damage (PMID: 8944033). As a transcriptional co-regulator, BTG2 has been shown to interact with CAF1 and POP2, and works as a co-activator of ERa-mediated transcription via a CCR4-like complex (PMID: 18974182).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17819 Product name: Recombinant human BTG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC105949 Sequence: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY Predict reactive species\nFull Name: BTG family, member 2\nCalculated Molecular Weight: 158 aa, 17 kDa\nGenBank Accession Number: BC105949\nGene Symbol: BTG2\nGene ID (NCBI): 7832\nRRID: AB_2879078\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78543\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915847337,"sku":"22339-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22339-1-ap","provider":"Iright","version":"1.0","type":"link"}