{"product_id":"proteintech-22341-1-ap","title":"Proteintech, 22341-1-AP, L-VEGFA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe L-VEGFA (22341-1-AP) by Proteintech is a Polyclonal antibody targeting L-VEGFA in WB, IHC, ELISA applications with reactivity to human samples\n22341-1-AP targets L-VEGFA in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, bEnd.3 cells,  SH-SY5Y cells\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVEGFA, also named as VEGF or VPF, belongs to the PDGF\/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1\/VEGFR1 and KDR\/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17831 Product name: Recombinant human L-VEGFA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC065522 Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETM Predict reactive species\nFull Name: vascular endothelial growth factor A\nCalculated Molecular Weight: 412 aa, 46 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC065522\nGene Symbol: VEGFA\nGene ID (NCBI): 7422\nRRID: AB_2879080\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15692\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869470380201,"sku":"22341-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22341-1-ap","provider":"Iright","version":"1.0","type":"link"}