{"product_id":"proteintech-22357-1-ap","title":"Proteintech, 22357-1-AP, CXorf15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXorf15 (22357-1-AP) by Proteintech is a Polyclonal antibody targeting CXorf15 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n22357-1-AP targets CXorf15 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  HEK-293 cells,  Jurkat cells,  MCF-7 cells\nPositive IHC detected in: mouse heart tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17936 Product name: Recombinant human CXorf15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 447-528 aa of BC101576 Sequence: ELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAPAIESVD Predict reactive species\nFull Name: chromosome X open reading frame 15\nCalculated Molecular Weight: 528 aa, 61 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC101576\nGene Symbol: CXorf15\nGene ID (NCBI): 55787\nRRID: AB_2879087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9NUQ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869667152041,"sku":"22357-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22357-1-ap","provider":"Iright","version":"1.0","type":"link"}