{"product_id":"proteintech-22392-1-ap","title":"Proteintech, 22392-1-AP, IRF7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF7 (22392-1-AP) by Proteintech is a Polyclonal antibody targeting IRF7 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n22392-1-AP targets IRF7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF-7 (IFN regulatory factor 7) is a member of the IFN regulatory transcription factor (IRF) family. IRF-7 has been shown to play a role in the transcriptional activation of virus-inducible cellular proteins, including IFN beta chain proteins. Inducible expression of IRF-7 is largely restricted to lymphoid tissue. Four transcript variants encoding distinct isoforms (A,B,C and D) have been identified for this (PMID:9786932).The active IRF7A exists as a dimer form ~80 kDa(PMID:11073981). The MW 67-70 kDa has been reported in some papers (PMID:9786932; 22951831).Various posttranslational modifications of IRF7 including phosphorylation, ubiquitination, sumoylation and acetylation are identified (PMID:22951831).This antibody is a rabbit polyclonal antibody raised against the C-terminal 349 amino acid residues of human IRF7 D. The molecular weight of Nonphosphorylated IRF7 cofractionated with the 44-kDa marker, approximating its predicted size. In contrast, phosphorylated IRF7, which migrate more slowly on SDS-PAGE. This phosphorylated IRF7 was consistent with a size of 80 to 90 kDa. (PMID: 11073981 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig, duck, paralichthys olivaceus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18059 Product name: Recombinant human IRF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-516 aa of BC136555 Sequence: PGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA Predict reactive species\nFull Name: IRF 7\nCalculated Molecular Weight: 516 aa, 56 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC136555\nGene Symbol: IRF7\nGene ID (NCBI): 3665\nRRID: AB_2879097\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92985\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858994857,"sku":"22392-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22392-1-ap","provider":"Iright","version":"1.0","type":"link"}