{"product_id":"proteintech-22399-1-ap","title":"Proteintech, 22399-1-AP, Syntenin-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Syntenin-1 (22399-1-AP) by Proteintech is a Polyclonal antibody targeting Syntenin-1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n22399-1-AP targets Syntenin-1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human placenta tissue,  HeLa cells,  HepG2 cells,  MCF-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissue, mouse brain tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSyntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18078 Product name: Recombinant human SDCBP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 12-139 aa of BC113674 Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ Predict reactive species\nFull Name: syndecan binding protein (syntenin)\nCalculated Molecular Weight: 298 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC113674\nGene Symbol: Syntenin-1\nGene ID (NCBI): 6386\nRRID: AB_2879100\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00560\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868863516841,"sku":"22399-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22399-1-ap","provider":"Iright","version":"1.0","type":"link"}