{"product_id":"proteintech-22426-1-ap","title":"Proteintech, 22426-1-AP, HNF1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HNF1A (22426-1-AP) by Proteintech is a Polyclonal antibody targeting HNF1A in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n22426-1-AP targets HNF1A in WB, IHC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, SMMC-7721 cells,  HuH-7 cells\nPositive IP detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHNF-1 , a homoeprotein family designated the Hepatocyte Nuclear Factor family. The various HNF-1 isoforms regulate transcription of genes in the liver as well as in other tissues such as kidney, small intestine and thymus. HNF1 as a transcriptional activator that regulates the tissue specific expression of multiple genes, especially in pancreatic islet cells and in liver. It is required for the expression of several liver specific genes and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18188 Product name: Recombinant human HNF1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-631 aa of BC104910 Sequence: PLHPSYQQPLMPPVQSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ Predict reactive species\nFull Name: HNF1 homeobox A\nCalculated Molecular Weight: 631 aa, 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC104910\nGene Symbol: HNF1A\nGene ID (NCBI): 6927\nRRID: AB_2879104\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P20823\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906246313,"sku":"22426-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22426-1-ap","provider":"Iright","version":"1.0","type":"link"}