{"product_id":"proteintech-22441-1-ap","title":"Proteintech, 22441-1-AP, LARG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LARG (22441-1-AP) by Proteintech is a Polyclonal antibody targeting LARG in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n22441-1-AP targets LARG in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLARG, also known as ARHGEF12, is one of three regulator of G protein signalling (RGS) domain-containing RhoGEFs. LARG activates the ROCK pathway downstream of Gα12\/13 signaling, leading to cytoskeletal reorganisation. LARG performs this activity either as a homodimer or as a heterodimer with Arhgef11. LARG has been implicated in many diseases, including cancer, heart disease, and in HIV viral replication. LARG is phosphorylated and dephosphorylated during mitosis and that Cdk1 is the mitotic kinase responsible for LARG phosphorylation. We got 220 kDa in western blotting, maybe due to its phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18211 Product name: Recombinant human LARG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-563 aa of BC063117 Sequence: QRLLKEIQEAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSM Predict reactive species\nFull Name: Rho guanine nucleotide exchange factor (GEF) 12\nCalculated Molecular Weight: 1544 aa, 173 kDa\nObserved Molecular Weight: 220 kDa\nGenBank Accession Number: BC063117\nGene Symbol: LARG\nGene ID (NCBI): 23365\nRRID: AB_2879107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZN5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868969226409,"sku":"22441-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22441-1-ap","provider":"Iright","version":"1.0","type":"link"}