{"product_id":"proteintech-22556-1-ap","title":"Proteintech, 22556-1-AP, FTSJ2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FTSJ2 (22556-1-AP) by Proteintech is a Polyclonal antibody targeting FTSJ2 in WB, IP, ELISA applications with reactivity to human,  mouse samples\n22556-1-AP targets FTSJ2 in WB, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue,  human placenta tissue\nPositive IP detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPutative ribosomal RNA methyltransferase 2 (FTSJ2), also named as FJH1 or Protein FTSJ homolog 2 is a 246 amino acid protein, which belongs to the methyl-transferase superfamily. FTSJ2 localizes in the nucleus and is widely expressed in in muscle, placenta, and heart. FTSJ2  functions as a nucleolar RNA methyl-transferase involved in eukaryotic RNA processing and modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18410 Product name: Recombinant human FTSJ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC114514 Sequence: MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPSLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ Predict reactive species\nFull Name: FtsJ homolog 2 (E. coli)\nCalculated Molecular Weight: 246 aa, 27 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC114514\nGene Symbol: FTSJ2\nGene ID (NCBI): 29960\nRRID: AB_2879122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9UI43\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644168361,"sku":"22556-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22556-1-ap","provider":"Iright","version":"1.0","type":"link"}