{"product_id":"proteintech-22578-1-ap","title":"Proteintech, 22578-1-AP, ARAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARAP3 (22578-1-AP) by Proteintech is a Polyclonal antibody targeting ARAP3 in IHC, ELISA applications with reactivity to human samples\n22578-1-AP targets ARAP3 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ADP-ribosylation factor (ARF) family of small GTP-binding proteins are involved in vesicular transport regulation and in controlling cytoskeletal organization and cell adhesion. These proteins are best characterized as regulators of membrane traffic. The Centaurin GTPase-activating protein family comprise a subset of ARF regulatory molecules that transduce PI 3-kinase activation into coordinated control of ARF-dependent pathways. ARAP3 (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3) is unique for its dual specificity GAPs (GTPase activating protein) activity for Arf6 (ADP-ribosylation factor 6) and RhoA (Ras homolog gene family member A) regulated by PtdIns(3,4,5)P3 (phosphatidylinositol (3,4,5)-trisphosphate) and a small GTPase Rap1-GTP and is involved in regulation of cell shape and adhesion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17436 Product name: Recombinant human ARAP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1225-1544 aa of BC009968 Sequence: PRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLKEKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSILKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLTSQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETTAGLGSPSQPTSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT Predict reactive species\nFull Name: ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3\nCalculated Molecular Weight: 1544 aa, 170 kDa\nGenBank Accession Number: BC009968\nGene Symbol: ARAP3\nGene ID (NCBI): 64411\nRRID: AB_2879125\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWN8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885008212137,"sku":"22578-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22578-1-ap","provider":"Iright","version":"1.0","type":"link"}