{"product_id":"proteintech-22589-1-ap","title":"Proteintech, 22589-1-AP, PRICKLE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRICKLE1 (22589-1-AP) by Proteintech is a Polyclonal antibody targeting PRICKLE1 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n22589-1-AP targets PRICKLE1 in WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  Neuro-2a cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRICKLE1, also known as RILP, EPM1B, encodes a cytoplasmic protein with an N-terminal PET (Pk, Espinas, Testin) domain, three LIM domains and a C-terminal PKH (prickle homologous) domain. PRICKLE1 is expressed at the highest levels in placenta and lower levels in lung, liver, kidney and pancreas(PMID: 12525887). PRICKLE1 localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors REST\/NRSF and REST4. Mutations in PRICKLE1 have been linked to progressive myoclonus epilepsy(PMID: 18976727).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18407 Product name: Recombinant human PRICKLE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-580 aa of BC114939 Sequence: AFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKFPGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLLKFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGLGDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNM Predict reactive species\nFull Name: prickle homolog 1 (Drosophila)\nCalculated Molecular Weight: 831 aa, 94 kDa\nObserved Molecular Weight: 94 kDa, 55-60 kDa\nGenBank Accession Number: BC114939\nGene Symbol: PRICKLE1\nGene ID (NCBI): 144165\nRRID: AB_2879129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q96MT3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868927611049,"sku":"22589-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22589-1-ap","provider":"Iright","version":"1.0","type":"link"}