{"product_id":"proteintech-22658-1-ap","title":"Proteintech, 22658-1-AP, EYA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EYA1 (22658-1-AP) by Proteintech is a Polyclonal antibody targeting EYA1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22658-1-AP targets EYA1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse colon tissue,  HuH-7 cells,  NCCIT cells,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe EYA1 (Eyes absent homolog 1) gene is the human homologue of the Drosophila Eya1 gene, which is essential for eye development in that species. There are 4 different isoforms of EYA1 (EYA1A, EYA1B, EYA1C, EYA1D), which are composed of 559 amino acids (AA), 592 AA, 592 AA and 557 AA, respectively. It should be noted that isoforms B and C have the same length; however, they could be considered different variants because of change in amino acidic composition (PMID: 24803398).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18489 Product name: Recombinant human EYA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC121799 Sequence: MEMQDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETASTTADGSLNNFSGSAIGSSSFSPRPTHQFSPPQIYPSNRPYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD Predict reactive species\nFull Name: eyes absent homolog 1 (Drosophila)\nCalculated Molecular Weight: 592 aa, 65 kDa\nObserved Molecular Weight: 61 kDa and 65 kDa\nGenBank Accession Number: BC121799\nGene Symbol: EYA1\nGene ID (NCBI): 2138\nRRID: AB_2879145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99502\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901789865,"sku":"22658-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22658-1-ap","provider":"Iright","version":"1.0","type":"link"}