{"product_id":"proteintech-22670-1-ap","title":"Proteintech, 22670-1-AP, A4GNT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe A4GNT (22670-1-AP) by Proteintech is a Polyclonal antibody targeting A4GNT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22670-1-AP targets A4GNT in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, mouse pancreas tissue,  mouse stomach tissue,  rat stomach tissue,  L02 cells\nPositive IHC detected in: human stomach cancer tissue, human pancreas cancer tissue,  rat stomach tissue,  mouse stomach tissue,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nA4GNT (alpha-1,4-N-acetylglucosaminyltransferase) catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans, forming a unique glycan structure, GlcNAcalpha1--\u0026gt;4Galbeta--\u0026gt;R. The gene is expressed with a bias in certain tissues, particularly in the stomach (RPKM 9.5) and duodenum (RPKM 0.9). Alpha4GnT has been implicated in O-glycan biosynthesis and is thought to have a role in preventing gastric cancer by inhibiting Helicobacter pylori infection and suppressing tumor-promoting inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18432 Product name: Recombinant human A4GNT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 76-340 aa of BC119639 Sequence: KIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSDIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK Predict reactive species\nFull Name: alpha-1,4-N-acetylglucosaminyltransferase\nCalculated Molecular Weight: 340 aa, 39 kDa\nObserved Molecular Weight: 34-37 kDa\nGenBank Accession Number: BC119639\nGene Symbol: A4GNT\nGene ID (NCBI): 51146\nRRID: AB_11183768\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNA3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869797077161,"sku":"22670-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22670-1-ap","provider":"Iright","version":"1.0","type":"link"}