{"product_id":"proteintech-22683-1-ap","title":"Proteintech, 22683-1-AP, RBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBP1 (22683-1-AP) by Proteintech is a Polyclonal antibody targeting RBP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n22683-1-AP targets RBP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HEK-293 cells,  human brain tissue,  human liver tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissue,  human liver tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18572 Product name: Recombinant human RBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC121052 Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ Predict reactive species\nFull Name: retinol binding protein 1, cellular\nCalculated Molecular Weight: 135 aa, 16 kDa\nObserved Molecular Weight: 14-21 kDa\nGenBank Accession Number: BC121052\nGene Symbol: RBP1\nGene ID (NCBI): 5947\nRRID: AB_11182381\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09455\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920533161,"sku":"22683-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22683-1-ap","provider":"Iright","version":"1.0","type":"link"}