{"product_id":"proteintech-22723-1-ap","title":"Proteintech, 22723-1-AP, ARK5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARK5 (22723-1-AP) by Proteintech is a Polyclonal antibody targeting ARK5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22723-1-AP targets ARK5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat heart tissue,  mouse heart tissue\nPositive IHC detected in: human colon cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUAK1 is a member of the human adenosine monophosphate (AMP)-activated protein kinase family that has been identified as a key tumor cell survival factor. It is also named as ARK5, KIAA0537, OMPHK1 and belongs to the protein kinase superfamily. The physiological role of NUAK1 is potentially to suppress glucose uptake through negative regulation of INS signaling in oxidative muscle. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18612 Product name: Recombinant human NUAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 515-662 aa of BC152462 Sequence: HSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN Predict reactive species\nFull Name: NUAK family, SNF1-like kinase, 1\nCalculated Molecular Weight: 661 aa, 74 kDa\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC152462\nGene Symbol: ARK5\nGene ID (NCBI): 9891\nRRID: AB_2879157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O60285\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868905099433,"sku":"22723-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22723-1-ap","provider":"Iright","version":"1.0","type":"link"}