{"product_id":"proteintech-22770-1-ap","title":"Proteintech, 22770-1-AP, CCDC64B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC64B (22770-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC64B in WB, IHC, ELISA applications with reactivity to human samples\n22770-1-AP targets CCDC64B in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC64B, also named as BICDL2 and BICDR2, belongs to BICD family. It was officially named by Schlager et al (2010) in a sequence homology search for new mammalian BICD-like proteins. At present, there is still little study on this protein, which may involve the vesicle transport along microtubule, and Golgi to secretory granule transport. BICDR2 has 2 isoforms with the molecular mass of 57 and 34 kDa (PMID:20360680, 20485297).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18720 Product name: Recombinant human CCDC64B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-508 aa of BC128602 Sequence: LQSRRQDLEAQIRGLREEVEKGEGRLQTTHEELLLLRRERREHSLELERARSEAGEALSALRRLRRRVSELEEESRLQDADVSAASLQSELAHSLDDGDQGQGADAPGDTPTTRSPKTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQSLREELQRQKELRAQEDPGEALHSALSDRDEAVNKALELSLQLNRVSLERDSLSRELLRAIRQKVALTQELEAWQDDMQVVIGQQLRSQRQKELSASASSSTPRRAAPRFSLRLGPGPAGGFLSNLFRRT Predict reactive species\nFull Name: coiled-coil domain containing 64B\nCalculated Molecular Weight: 508 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC128602\nGene Symbol: CCDC64B\nGene ID (NCBI): 146439\nRRID: AB_2918078\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A1A5D9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885978013865,"sku":"22770-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22770-1-ap","provider":"Iright","version":"1.0","type":"link"}