{"product_id":"proteintech-22772-1-ap","title":"Proteintech, 22772-1-AP, MIXL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIXL1 (22772-1-AP) by Proteintech is a Polyclonal antibody targeting MIXL1 in WB, IF\/ICC, ELISA applications with reactivity to human, rat samples\n22772-1-AP targets MIXL1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  rat pancreas tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMix1 homeobox-like 1 (MIXL1) Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and\/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression. This antibody is specific to MIXL1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18732 Product name: Recombinant human MIXL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-232 aa of BC113441 Sequence: KSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF Predict reactive species\nFull Name: Mix1 homeobox-like 1 (Xenopus laevis)\nCalculated Molecular Weight: 232 aa, 25 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC113441\nGene Symbol: MIXL1\nGene ID (NCBI): 83881\nRRID: AB_2879164\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9H2W2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970307753,"sku":"22772-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22772-1-ap","provider":"Iright","version":"1.0","type":"link"}