{"product_id":"proteintech-22779-1-ap","title":"Proteintech, 22779-1-AP, LIFR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIFR (22779-1-AP) by Proteintech is a Polyclonal antibody targeting LIFR in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n22779-1-AP targets LIFR in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue, HeLa cells,  human placenta tissue,  mouse skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human skeletal muscle tissue, human kidney tissue,  human placenta tissue,  mouse cerebellum tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIFR, also known as CD118, is a subunit of a receptor for leukemia inhibitory factor (LIF). LIF is a pleiotropic cytokine of the interleukin-6 family which affects the differentiation, survival, and proliferation of a wide variety of cells in the adult and the embryo. LIFR is the low-affinity binding chain that, together with the high-affinity converter subunit gp130, forms a high-affinity receptor complex that mediates the action of LIF. The high-affinity complex also binds a related cytokine, oncostatin M (PMID: 8999038). LIFR has also been identified as a breast cancer metastasis suppressor that functions through the HIPPO-YAP pathway (PMID: 23001183). LIFR appeared as doublets with 190 and 170 kDa (PMID: 10858440). They represented different glycosylated forms of the LIFR in different steps of protein maturation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18742 Product name: Recombinant human LIFR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 906-1097 aa of BC153096 Sequence: NNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPNPAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEEDLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKSNGGGWSFTNFFQNKPND Predict reactive species\nFull Name: leukemia inhibitory factor receptor alpha\nCalculated Molecular Weight: 1097 aa, 124 kDa\nObserved Molecular Weight: 190 kDa, 170 kDa\nGenBank Accession Number: BC153096\nGene Symbol: LIFR\nGene ID (NCBI): 3977\nRRID: AB_2879165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P42702\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879409321,"sku":"22779-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22779-1-ap","provider":"Iright","version":"1.0","type":"link"}