{"product_id":"proteintech-22787-1-ap","title":"Proteintech, 22787-1-AP, MCT4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MCT4 (22787-1-AP) by Proteintech is a Polyclonal antibody targeting MCT4 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n22787-1-AP targets MCT4 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, unboiled PC-3 cells,  rat skeletal muscle tissue,  HepG2 cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissue,  human renal cell carcinoma tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18788 Product name: Recombinant human SLC16A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 402-465 aa of BC112269 Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV Predict reactive species\nFull Name: solute carrier family 16, member 3 (monocarboxylic acid transporter 4)\nCalculated Molecular Weight: 465 aa, 49 kDa\nObserved Molecular Weight: 38-42 kDa\nGenBank Accession Number: BC112269\nGene Symbol: MCT4\nGene ID (NCBI): 9123\nRRID: AB_11182479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15427\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868828979369,"sku":"22787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22787-1-ap","provider":"Iright","version":"1.0","type":"link"}