{"product_id":"proteintech-22789-1-ap","title":"Proteintech, 22789-1-AP, PHLPP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHLPP1 (22789-1-AP) by Proteintech is a Polyclonal antibody targeting PHLPP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22789-1-AP targets PHLPP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human liver tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHLPP (PH domain leucine-rich-repeats protein phosphatase) belongs to a novel family of Ser\/Thr protein phosphatases that consists of PHLPP1 and PHLPP2 isoforms. It has been shown that PHLPP negatively regulates multiple oncogenic pathways by directly dephosphorylating and inactivating key signaling molecules, including Akt, S6K, and RAF1. This antibody detects both PHLPP1 alpha and PHLPP1 beta isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18794 Product name: Recombinant human PHLPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1068-1204 aa of BC126277 Sequence: QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP Predict reactive species\nFull Name: PH domain and leucine rich repeat protein phosphatase\nCalculated Molecular Weight: 185 kDa, 134 kDa\nObserved Molecular Weight: 185 kDa\nGenBank Accession Number: BC126277\nGene Symbol: PHLPP\nGene ID (NCBI): 23239\nRRID: AB_2750897\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60346\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852900009,"sku":"22789-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22789-1-ap","provider":"Iright","version":"1.0","type":"link"}