{"product_id":"proteintech-22809-1-ap","title":"Proteintech, 22809-1-AP, Dectin-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Dectin-1 (22809-1-AP) by Proteintech is a Polyclonal antibody targeting Dectin-1 in WB, ELISA applications with reactivity to human samples\n22809-1-AP targets Dectin-1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, THP-1 cells,  U-937 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18924 Product name: Recombinant human CLEC7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC013385 Sequence: MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG Predict reactive species\nFull Name: C-type lectin domain family 7, member A\nCalculated Molecular Weight: 247 aa, 28 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC013385\nGene Symbol: Dectin-1\nGene ID (NCBI): 64581\nRRID: AB_3085702\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXN2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887129743529,"sku":"22809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22809-1-ap","provider":"Iright","version":"1.0","type":"link"}