{"product_id":"proteintech-22851-1-ap","title":"Proteintech, 22851-1-AP, OFD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OFD1 (22851-1-AP) by Proteintech is a Polyclonal antibody targeting OFD1 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n22851-1-AP targets OFD1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells, hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOFD1, also named CXorf5 and 71-7A, belongs to the OFD1 family. It has been implicated in several developmental syndromes, including a male-lethal X-linked dominant condition, Oral-Facial-Digital type 1 (OFD1) syndrome, X-linked recessiveSimpson-Golabi-Behmel syndrome type 2 (SGBS2), and Joubert syndrome and related disorders (JSRDs). It is a component of the centrioles controlling mother and daughter centrioles' length. It recruits to the centriole IFT88 and centriole distal appendage-specific proteins including CEP164. Involved in the biogenesis of the cilium, a centriole-associated function. OFD1 plays an important role in development by regulating Wnt signaling and the specification of the left-right axis. This antibody recognizes all the isoforms of OFD1. The 43 kDa is isoform 2. The ~80 kDa band is unknown.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18898 Product name: Recombinant human OFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC096344 Sequence: MMAQSNMFTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPRSISVEGSSLLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPTSSLYKSLVSGSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQRIKFESLEIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQ Predict reactive species\nFull Name: oral-facial-digital syndrome 1\nCalculated Molecular Weight: 1012 aa, 117 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC096344\nGene Symbol: OFD1\nGene ID (NCBI): 8481\nRRID: AB_2879177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75665\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971192489,"sku":"22851-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22851-1-ap","provider":"Iright","version":"1.0","type":"link"}