{"product_id":"proteintech-22861-1-ap","title":"Proteintech, 22861-1-AP, IL-22RA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-22RA2 (22861-1-AP) by Proteintech is a Polyclonal antibody targeting IL-22RA2 in WB, IHC, ELISA applications with reactivity to human samples\n22861-1-AP targets IL-22RA2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-453s cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-22 receptor subunit alpha-2 (IL22RA2, also known as CRF2-10) is a soluble member of the type II cytokine receptor family. Through binding to IL22, IL22RA2 prevents the interaction of IL22 with the functional IL22-R complex and blocks the activity of IL22 (in vitro). IL22RA2 may play an important role as an IL22 antagonist in the regulation of inflammatory responses. It has been described that human IL22RA2 gene encodes three alternatively spliced isoforms called CRF2-10L, CRF2-10, and CRF2-10s, with molecular weights of 31 kDa, 27 kDa, and 15 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18854 Product name: Recombinant human IL-22RA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-232 aa of BC125167 Sequence: MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP Predict reactive species\nFull Name: interleukin 22 receptor, alpha 2\nCalculated Molecular Weight: 263 aa, 31 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC125167\nGene Symbol: IL-22RA2\nGene ID (NCBI): 116379\nRRID: AB_2879180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969J5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887679885481,"sku":"22861-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22861-1-ap","provider":"Iright","version":"1.0","type":"link"}