{"product_id":"proteintech-22882-1-ap","title":"Proteintech, 22882-1-AP, MEX3C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEX3C (22882-1-AP) by Proteintech is a Polyclonal antibody targeting MEX3C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n22882-1-AP targets MEX3C in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  PC-3 cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEX3C(RNA-binding E3 ubiquitin-protein ligase MEX3C) is also named as RKHD2, RNF194 and may be involved in post-transcriptional regulatory mechanisms. MEX3C is necessary for normal postnatal growth and enhances the expression of local bone Igf1 expression(PMID:22927639). This protein is expressed in the cytoplasm and shuttles between the cytoplasm and the nucleus through the CRM1 export pathway. At least three MEX3C protein variants can be expressed by alternative splicing and alternative transcription initiation: MEX3C659AA(containing 659 amino acid residues, about 82 kDa), MEX3C464AA(about 64 kDa) and MEX3C372AA(about 50 kDa)(PMID: 28982131,27053362,22863774).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18931 Product name: Recombinant human MEX3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-415 aa of BC148855 Sequence: GSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVI Predict reactive species\nFull Name: mex-3 homolog C (C. elegans)\nCalculated Molecular Weight: 659 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC148855\nGene Symbol: MEX3C\nGene ID (NCBI): 51320\nRRID: AB_2879183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5U5Q3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559279785,"sku":"22882-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22882-1-ap","provider":"Iright","version":"1.0","type":"link"}