{"product_id":"proteintech-22883-1-ap","title":"Proteintech, 22883-1-AP, HSF4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSF4 (22883-1-AP) by Proteintech is a Polyclonal antibody targeting HSF4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22883-1-AP targets HSF4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  mouse brain tissue,  mouse lung tissue,  rat brain tissue,  mouse heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProkaryotic and eukaryotic cells respond to thermal and chemical stress by inducing a group of genes collectively designated heat shock genes. In eukaryotes, this gene expression is regulated primarily at the transcriptionlevel. Heat shock transcription factors (HSF, also designated HSTF) 1 and 2 are involved in this regulation. HSF1 and HSF2 are upregulated by estrogen, at both the mRNA and protein level. HSF1 is normally found as a monomer, whose transcriptional activity is repressed by constitutive phosphorylation. Upon activation, HSF1 forms trimers, gains DNA binding activity and is translocated to the nucleus. HSF2 activity is associated with differentiation and development, and, like HSF1, binds DNA as a trimer. HSF4 exists as two splice variants and is expressed in heart, brain and skeletal muscle as a homotrimer. HSF4a does not contain a DNA-binding domain and inhibits the formation of HSF1 nuclear bodies, thus repressing HSF1 mediated transcription. HSF4b does contain a DNA-binding domain and colocalizes with HSF1 nuclear bodies after heat shock. This antibody is specific to human HSF4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18935 Product name: Recombinant human HSF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 340-462 aa of BC153061 Sequence: DRSPESLLPPMLLQPPQESVEPAGPLDVLGPSLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSPGKDPTLGAPLLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASPSP Predict reactive species\nFull Name: heat shock transcription factor 4\nCalculated Molecular Weight: 492 aa, 53 kDa\nObserved Molecular Weight: 62-66 kDa\nGenBank Accession Number: BC153061\nGene Symbol: HSF4\nGene ID (NCBI): 3299\nRRID: AB_2879184\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9ULV5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869695627433,"sku":"22883-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22883-1-ap","provider":"Iright","version":"1.0","type":"link"}