{"product_id":"proteintech-22938-1-ap","title":"Proteintech, 22938-1-AP, SIX5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIX5 (22938-1-AP) by Proteintech is a Polyclonal antibody targeting SIX5 in WB, IHC, IP, ELISA applications with reactivity to human samples\n22938-1-AP targets SIX5 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Y79 cells\nPositive IP detected in: Y79 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18993 Product name: Recombinant human SIX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 586-739 aa of BC156983 Sequence: PLKPETAISVPEGGLPVAPSPALPEAHALGTLSAQQPPPAAATTSSTSLPFSPDSPGLLPNFPAPPPEGLMLSPAAVPVWSAGLELSAGTEGLLEAEKGLGTQAPHTVLRLPDPDPEGLLLGATAGGEVDEGLEAEAKVLTQLQSVPVEEPLEL Predict reactive species\nFull Name: SIX homeobox 5\nCalculated Molecular Weight: 739 aa, 75 kDa\nObserved Molecular Weight: 100-105 kDa\nGenBank Accession Number: BC156983\nGene Symbol: SIX5\nGene ID (NCBI): 147912\nRRID: AB_2879186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N196\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869601714345,"sku":"22938-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22938-1-ap","provider":"Iright","version":"1.0","type":"link"}