{"product_id":"proteintech-22988-1-ap","title":"Proteintech, 22988-1-AP, CDKAL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDKAL1 (22988-1-AP) by Proteintech is a Polyclonal antibody targeting CDKAL1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  mouse samples\n22988-1-AP targets CDKAL1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue,  HepG2 cells,  HT-1080 cells,  Jurkat cells\nPositive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCell cycle progression is controlled, in part, by a family of cyclin dependent kinases (Cdks) that work to phosphorylate key substrates involved in each phase of cell cycle progression. Cdks are the catalytic subunits of serine\/threonine protein kinases, a large family of proteins that act as regulators of the eukaryotic cell cycle. CDKAL1 (Cdk5 regulatory subunit associated protein 1-like 1) is a 579 amino acid single-pass membrane protein that contains one TRAM domain and is similar to Cdk5 regulatory subunit associated proteins (CDK5RAPs). Expressed in pancreas, brain and skeletal muscle, CDKAL1 uses iron as a cofactor and is involved in glucose-stimulated INS secretion. Defects in the gene encoding CDKAL1 impair INS secretion and are associated with the development of type 2 diabetes. Multiple isoforms of CDKAL1 exist due to alternative splicing events. This antibody recognizes the 65kd isoform of CDKAL1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19060 Product name: Recombinant human CDKAL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-357 aa of BC121020 Sequence: MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGIT Predict reactive species\nFull Name: CDK5 regulatory subunit associated protein 1-like 1\nCalculated Molecular Weight: 579 aa, 65 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC121020\nGene Symbol: CDKAL1\nGene ID (NCBI): 54901\nRRID: AB_2879192\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q5VV42\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869523726505,"sku":"22988-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22988-1-ap","provider":"Iright","version":"1.0","type":"link"}