{"product_id":"proteintech-22989-1-ap","title":"Proteintech, 22989-1-AP, MMP12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP12 (22989-1-AP) by Proteintech is a Polyclonal antibody targeting MMP12 in WB, ELISA applications with reactivity to human, mouse, rat samples\n22989-1-AP targets MMP12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rabbit, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19068 Product name: Recombinant human MMP12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 231-402 aa of BC112301 Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR Predict reactive species\nFull Name: matrix metallopeptidase 12 (macrophage elastase)\nCalculated Molecular Weight: 470 aa, 54 kDa\nObserved Molecular Weight: 54 kDa, 45 kDa\nGenBank Accession Number: BC112301\nGene Symbol: MMP12\nGene ID (NCBI): 4321\nRRID: AB_2879193\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P39900\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852703401,"sku":"22989-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-22989-1-ap","provider":"Iright","version":"1.0","type":"link"}