{"product_id":"proteintech-23006-1-ap","title":"Proteintech, 23006-1-AP, SCP2\/SCPx Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCP2\/SCPx (23006-1-AP) by Proteintech is a Polyclonal antibody targeting SCP2\/SCPx in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n23006-1-AP targets SCP2\/SCPx in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HEK-293 cells,  K-562 cells,  NIH\/3T3 cells,  HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. 23006-1-AP antibody recognizes the 13-15 kDa SCP2 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19215 Product name: Recombinant human SCP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 405-547 aa of BC005911 Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL Predict reactive species\nFull Name: sterol carrier protein 2\nCalculated Molecular Weight: 547 aa, 59 kDa\nObserved Molecular Weight: 13-15 kDa\nGenBank Accession Number: BC005911\nGene Symbol: SCP2\nGene ID (NCBI): 6342\nRRID: AB_2879197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22307\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914503849,"sku":"23006-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23006-1-ap","provider":"Iright","version":"1.0","type":"link"}