{"product_id":"proteintech-23024-1-ap","title":"Proteintech, 23024-1-AP, SCP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCP3 (23024-1-AP) by Proteintech is a Polyclonal antibody targeting SCP3 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n23024-1-AP targets SCP3 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HepG2 cells,  rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19330 Product name: Recombinant human SYCP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-236 aa of BC062662 Sequence: GKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF Predict reactive species\nFull Name: synaptonemal complex protein 3\nCalculated Molecular Weight: 236 aa, 28 kDa\nObserved Molecular Weight: 30 kDa, 33 kDa\nGenBank Accession Number: BC062662\nGene Symbol: SYCP3\nGene ID (NCBI): 50511\nRRID: AB_11232426\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZU3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868853457065,"sku":"23024-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23024-1-ap","provider":"Iright","version":"1.0","type":"link"}