{"product_id":"proteintech-23081-1-ap","title":"Proteintech, 23081-1-AP, Alpha smooth muscle actin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha smooth muscle actin (23081-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha smooth muscle actin in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n23081-1-AP targets Alpha smooth muscle actin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse brown adipose tissue,  mouse kidney tissue,  mouse liver tissue,  mouse skeletal muscle tissue,  rat heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human heart tissue, mouse skeletal muscle tissue,  human colon tissue,  human liver cancer tissue,  stromal tumor tissue,  human hysteromyoma tissue,  human liver tissue,  human small intestine tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACTA2 (also known as α-smooth muscle actin or α-SMA) belongs to the actin family. Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. ACTA2 is primarily expressed in vascular smooth muscle and anti-ACTA2 is commonly used to marker smooth muscle cells. This antibody is specific to the ACTA2. It selectively stains the vascular smooth muscle but not cardiac or skeletal muscle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19481 Product name: Recombinant human ACTA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC017554 Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG Predict reactive species\nFull Name: actin, alpha 2, smooth muscle, aorta\nCalculated Molecular Weight: 377 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC017554\nGene Symbol: Alpha smooth muscle actin\nGene ID (NCBI): 59\nRRID: AB_2815024\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868847526057,"sku":"23081-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23081-1-ap","provider":"Iright","version":"1.0","type":"link"}