{"product_id":"proteintech-23094-1-ap","title":"Proteintech, 23094-1-AP, LRRTM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRRTM2 (23094-1-AP) by Proteintech is a Polyclonal antibody targeting LRRTM2 in WB, ELISA applications with reactivity to human,  mouse samples\n23094-1-AP targets LRRTM2 in WB, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spinal cord tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine-rich repeat transmembrane proteins (LRRTMs) are synaptic cell adhesion molecules. LRRTMs are highly localized in the postsynaptic density and play various roles in the formation, maturation, and function of synapses (PMID: 25951919). LRRTM2 acts as a post-synaptic ligand of Neurexins. LRRTM2 regulates excitatory synapse development and function in the vertebrate nervous system (PMID: 20064387).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19422 Product name: Recombinant human LRRTM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-136 aa of BC126408 Sequence: CRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRHNHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQ Predict reactive species\nFull Name: leucine rich repeat transmembrane neuronal 2\nCalculated Molecular Weight: 516 aa, 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC126408\nGene Symbol: LRRTM2\nGene ID (NCBI): 26045\nRRID: AB_2879209\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O43300\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869704704169,"sku":"23094-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23094-1-ap","provider":"Iright","version":"1.0","type":"link"}