{"product_id":"proteintech-23117-1-ap","title":"Proteintech, 23117-1-AP, ESRP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESRP2 (23117-1-AP) by Proteintech is a Polyclonal antibody targeting ESRP2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n23117-1-AP targets ESRP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nESRP2 (Epithelial Splicing Regulatory Protein 2), also known as RBM35B(RNA binding motif protein 35B), is a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) family of RNA binding proteins. ESRP2 plays a role in the regulation of alternative splicing events of pre-mRNAs(PMID: 27401076). Overexpression of  ESRP2 has been described in various malignant tumors, such as pancreatic ductal adenocarcinoma, oral squamous carcinoma, ovarian cancer, and luminal-type breast cancer(PMID: 33339518).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19436 Product name: Recombinant human ESRP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 576-717 aa of BC030146 Sequence: TYTTFQATPTLIPTETAALYPSSALLPAARVPAAPTPVAYYPGPATQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL Predict reactive species\nFull Name: epithelial splicing regulatory protein 2\nCalculated Molecular Weight: 727 aa, 78 kDa\nObserved Molecular Weight: 78 kDa\nGenBank Accession Number: BC030146\nGene Symbol: ESRP2\nGene ID (NCBI): 80004\nRRID: AB_2879213\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6T0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869680095401,"sku":"23117-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23117-1-ap","provider":"Iright","version":"1.0","type":"link"}