{"product_id":"proteintech-23183-1-ap","title":"Proteintech, 23183-1-AP, GATC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GATC (23183-1-AP) by Proteintech is a Polyclonal antibody targeting GATC in IP, IHC, ELISA applications with reactivity to human, mouse samples\n23183-1-AP targets GATC in IP, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGATC encodes a subunit of the glutamyl-tRNA(Gln) amidotransferase protein complex (GatCAB), which plays a role in aminoacylation of mitochondrial glutaminyl mt-tRNA. The complex plays an role in mitochondrial translation and protein synthesis (PubMed: 30283131).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19713 Product name: Recombinant human GATC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC107145 Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS Predict reactive species\nFull Name: glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)\nCalculated Molecular Weight: 136 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC107145\nGene Symbol: GATC\nGene ID (NCBI): 283459\nRRID: AB_2879226\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O43716\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887647871145,"sku":"23183-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23183-1-ap","provider":"Iright","version":"1.0","type":"link"}