{"product_id":"proteintech-23237-1-ap","title":"Proteintech, 23237-1-AP, TBX18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBX18 (23237-1-AP) by Proteintech is a Polyclonal antibody targeting TBX18 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n23237-1-AP targets TBX18 in WB, IF, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  human placenta tissue,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human kidney tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe T-box (Tbx) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The Tbx gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. Tbx genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in Tbx genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of Tbx products has come mainly from the prototypical T\/Brachyury, which is a transcription activator. The Tbx genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.This antibody specifically reacts with the 65kd TBX18 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19258 Product name: Recombinant human TBX18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 350-532 aa of BC157841 Sequence: PSLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGY Predict reactive species\nFull Name: T-box 18\nCalculated Molecular Weight: 607 aa, 65 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC157841\nGene Symbol: TBX18\nGene ID (NCBI): 9096\nRRID: AB_2879237\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O95935\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869611774121,"sku":"23237-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23237-1-ap","provider":"Iright","version":"1.0","type":"link"}