{"product_id":"proteintech-23418-1-ap","title":"Proteintech, 23418-1-AP, Osteocalcin\/OCN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Osteocalcin\/OCN (23418-1-AP) by Proteintech is a Polyclonal antibody targeting Osteocalcin\/OCN in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n23418-1-AP targets Osteocalcin\/OCN in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissue, human osteosarcoma tissue,  human testis tissue,  rat testis tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, NIH\/3T3 cells\nPositive FC (Intra) detected in: NIH\/3T3 cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOsteocalcin is a small, highly conserved molecule associated with mineralization of bone matrix. Osteocalcin is specifically expressed in osteoblasts and is the most abundant non-collagenous protein in bone. It regulates the dynamics of new bone formation and bone resorption by interaction with vitamin D, and by influencing the differentiation of osteoblasts. Osteocalcin is also involved in the posttranslational targeting of vitamin K-dependent gamma-carboxylation, which controls blood coagulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, canine, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20065 Product name: Recombinant human Osteocalcin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-100 aa of BC113432 Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Predict reactive species\nFull Name: bone gamma-carboxyglutamate (gla) protein\nCalculated Molecular Weight: 100 aa, 11 kDa\nGenBank Accession Number: BC113432\nGene Symbol: Osteocalcin\nGene ID (NCBI): 632\nRRID: AB_2879275\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02818\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822327465,"sku":"23418-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23418-1-ap","provider":"Iright","version":"1.0","type":"link"}